PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G145690_P01
Common NameZm.41296
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 735aa    MW: 80270.6 Da    PI: 6.5446
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G145690_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.91.1e-201873156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                       +++ +++t+ q+++Le++F+++++p++++r +L+++lgL+ rq+k+WFqNrR+++k
  GRMZM2G145690_P01 18 KKRYHRHTPRQIQQLEAMFKECPHPDENQRMQLSRELGLEPRQIKFWFQNRRTQMK 73
                       678899***********************************************998 PP

2START161.37.3e-512444672206
                        HHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
              START   2 laeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                        +a +a++el+++a+a+e +Wvk    e +n d++ ++f++ ++       ++e +r++g+v+m +  lv  ++d++ +W+e ++    ka t
  GRMZM2G145690_P01 244 MATRAMDELIRMAQAGEHLWVKTGgrEVLNVDTYDSIFAKPDGsfrgpdVHVEGSRETGLVFMSAIGLVDMFMDSS-KWTELFPaivsKART 334
                        5789*******************9999999999999998877799*******************************.*************** PP

                        EEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEE CS
              START  82 levissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtw 166
                        ++v+ +g     + l lm+ el ++sp+vp R+f f+Ry+rq + g w+i+d+Svd++q      ++  R+ +lpSg+li ++++g skvtw
  GRMZM2G145690_P01 335 VDVLVNGmggrsESLLLMYEELHVMSPVVPtREFCFLRYCRQIEHGLWAIADISVDQQQRDARfGAPPSRSCRLPSGCLIADMADGSSKVTW 426
                        ************************************************************999*99999*********************** PP

                        EE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 167 vehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                        veh++ ++r+p h l+r lv sg+a+ga +w+a+lqr ce+
  GRMZM2G145690_P01 427 VEHMEIEDRVPiHLLYRDLVLSGAAFGAHRWLAALQRACER 467
                        ***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.55E-20775IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-221381IPR009057Homeodomain-like
PROSITE profilePS5007118.0581575IPR001356Homeobox domain
SMARTSM003891.4E-191679IPR001356Homeobox domain
CDDcd000861.35E-191776No hitNo description
PfamPF000463.2E-181873IPR001356Homeobox domain
PROSITE patternPS0002705073IPR017970Homeobox, conserved site
PROSITE profilePS5084846.73234470IPR002913START domain
SuperFamilySSF559614.19E-31235468No hitNo description
CDDcd088751.68E-108238466No hitNo description
SMARTSM002347.0E-39243467IPR002913START domain
PfamPF018523.9E-43244467IPR002913START domain
Gene3DG3DSA:3.30.530.207.6E-6347443IPR023393START-like domain
SuperFamilySSF559614.26E-20497727No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 735 aa     Download sequence    Send to blast
MDFGDDVMDG GSDAQRRKKR YHRHTPRQIQ QLEAMFKECP HPDENQRMQL SRELGLEPRQ  60
IKFWFQNRRT QMKAQHERQD NCFLRAENDK IRCENIAMQE ALRNVICPTC GGPPVADDHF  120
DEQKLRMENA RLKEEASRFA FTIALAPGPA SLDGPAILPR SSFTFTSGDL DRVSSLTSKY  180
LGRPITQLPS AQALSMSSLD LSVGGLGGPS LDLDLLSGGS SGYPPFHLLP MAVSEMERPM  240
MAEMATRAMD ELIRMAQAGE HLWVKTGGRE VLNVDTYDSI FAKPDGSFRG PDVHVEGSRE  300
TGLVFMSAIG LVDMFMDSSK WTELFPAIVS KARTVDVLVN GMGGRSESLL LMYEELHVMS  360
PVVPTREFCF LRYCRQIEHG LWAIADISVD QQQRDARFGA PPSRSCRLPS GCLIADMADG  420
SSKVTWVEHM EIEDRVPIHL LYRDLVLSGA AFGAHRWLAA LQRACERCAC LATAGIMPHR  480
DIAAAGDISH RELLAVTPEG KRSMMKLSQR MVNSFCASLS ASQLHRWTTL SGPNDVGVRV  540
MVHRSTDPGQ PSGVVLSAAT SIWLPVPCDR AFAFVRDEHT RSQWDVLSHG NPVQEVSRIP  600
NGSHPGNCIS LLRGLNASQN SMLILQESCT DASGSLVVYA PIDIPAANVV MSGEDPSAIP  660
LLPSGFSILP DGRPGASSSR AGQAPSAGSL VTVAFQILVS SLPSAKLNAE SVATVNSLIS  720
TTVEQIKAAL NCASH
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.387650.0meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G145690
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G145690_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7285230.0KJ728523.1 Zea mays clone pUT6828 HB transcription factor (HB83) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001310555.10.0uncharacterized protein LOC100502181
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLA0A096SF430.0A0A096SF43_MAIZE; Uncharacterized protein
STRINGGRMZM2G145690_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11